Loading...
Statistics
Advertisement

Home - Nelson and Diana - The Gallery
www.npdp2015.com/

Npdp2015.com

Advertisement
Npdp2015.com is hosted in United States / Chicago . Npdp2015.com uses HTTPS protocol. Number of used technologies: 6. First technologies: AJAX Libraries API, CSS, Google Font API, Number of used javascripts: 6. First javascripts: Jquery.min.js, Functions_stripped.js, Get_deps.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Npdp2015.com

Technology

Number of occurences: 6
  • AJAX Libraries API
  • CSS
  • Google Font API
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 6
  • jquery.min.js
  • functions_stripped.js
  • get_deps.js
  • build_social_entries.js
  • wp-menu.js
  • jQuery.circleMenu.js

Server Type

  • Apache

Powered by

  • PHP/5.4.45-0+deb7u3

Social

Number of occurences: 1
  • Add This

Conversion rate optimization

visitors Clickable call number Founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Npdp2015.com

SSL certificate

    • name: /C=US/ST=New York/L=Bethpage/O=CableVision Systems Corporation/OU=CableVision Systems Corporation/CN=*.webhosting.optonline.net
    • subject:
      • C: US
      • ST: New York
      • L: Bethpage
      • O: CableVision Systems Corporation
      • OU: CableVision Systems Corporation
      • CN: *.webhosting.optonline.net
    • hash: 5270fe60
    • issuer:
      • C: US
      • O: DigiCert Inc
      • OU: www.digicert.com
      • CN: DigiCert SHA2 High Assurance Server CA
    • version: 2
    • serialNumber: 16774878612456667923214140529487847288
    • validFrom: 150930000000Z
    • validTo: 161115120000Z
    • validFrom_time_t: 1443571200
    • validTo_time_t: 1479211200
    • extensions:
      • authorityKeyIdentifier: keyid:51:68:FF:90:AF:02:07:75:3C:CC:D9:65:64:62:A2:12:B8:59:72:3B
      • subjectKeyIdentifier: 5B:B4:CC:18:12:EF:5F:98:EA:51:99:4C:F4:1A:DE:B3:E8:77:25:21
      • subjectAltName: DNS:*.webhosting.optonline.net, DNS:webhosting.optonline.net
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl3.digicert.com/sha2-ha-server-g4.crl Full Name: URI:http://crl4.digicert.com/sha2-ha-server-g4.crl
      • certificatePolicies: Policy: 2.16.840.1.114412.1.1 CPS: https://www.digicert.com/CPS
      • authorityInfoAccess: OCSP - URI:http://ocsp.digicert.com CA Issuers - URI:http://cacerts.digicert.com/DigiCertSHA2HighAssuranceServerCA.crt
      • basicConstraints: CA:FALSE

Meta - Npdp2015.com

Number of occurences: 3
  • Name:
    Content: text/html; charset=UTF-8
  • Name: viewport
    Content: width=device-width, initial-scale=1, maximum-scale=1
  • Name: robots
    Content: index,follow

Server / Hosting

  • IP: 216.110.144.252
  • Latitude: 41.88
  • Longitude: -87.64
  • Country: United States
  • City: Chicago

Rname

  • bdns.cv.siteprotect.com
  • adns.cv.siteprotect.com
  • mail.npdp2015.com

Target

  • hostmaster.npdp2015.com

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 19 Jul 2016 19:27:41 GMT Server: Apache X-Powered-By: PHP/5.4.45-0+deb7u3 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=ib1l3me3knp4oag2svqu0n36i6; path=/ Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Transfer-Encoding: chunked Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

DNS

host: npdp2015.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 216.110.144.252
host: npdp2015.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: bdns.cv.siteprotect.com
host: npdp2015.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: adns.cv.siteprotect.com
host: npdp2015.com
  1. class: IN
  2. ttl: 14400
  3. type: SOA
  4. mname: adns.cv.siteprotect.com
  5. rname: hostmaster.npdp2015.com
  6. serial: 2015011321
  7. refresh: 172800
  8. retry: 900
  9. expire: 1209600
  10. minimum-ttl: 3600
host: npdp2015.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 10
  5. target: mail.npdp2015.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.pdp2015.com, www.nnpdp2015.com, www.npdp2015.com, www.nhpdp2015.com, www.hpdp2015.com, www.njpdp2015.com, www.jpdp2015.com, www.nkpdp2015.com, www.kpdp2015.com, www.nlpdp2015.com, www.lpdp2015.com, www.n pdp2015.com, www. pdp2015.com, www.ndp2015.com, www.npidp2015.com, www.nidp2015.com, www.npkdp2015.com, www.nkdp2015.com, www.npudp2015.com, www.nudp2015.com, www.npjdp2015.com, www.njdp2015.com, www.npldp2015.com, www.nldp2015.com, www.npp2015.com, www.npdtp2015.com, www.nptp2015.com, www.npdgp2015.com, www.npgp2015.com, www.npdbp2015.com, www.npbp2015.com, www.npdxp2015.com, www.npxp2015.com, www.npdsp2015.com, www.npsp2015.com, www.npdfp2015.com, www.npfp2015.com, www.npdvp2015.com, www.npvp2015.com, www.npdyp2015.com, www.npyp2015.com, www.npdzp2015.com, www.npzp2015.com, www.npdap2015.com, www.npap2015.com, www.npdep2015.com, www.npep2015.com, www.npdrp2015.com, www.nprp2015.com, www.npd2015.com, www.npdpi2015.com, www.npdi2015.com, www.npdpk2015.com, www.npdk2015.com, www.npdpu2015.com, www.npdu2015.com, www.npdpj2015.com, www.npdj2015.com, www.npdpl2015.com, www.npdl2015.com, www.npdp015.com, www.npdp20015.com, www.npdp0015.com, www.npdp2q015.com, www.npdpq015.com, www.npdp2w015.com, www.npdpw015.com, www.npdp215.com, www.npdp20i15.com, www.npdp2i15.com, www.npdp20o15.com, www.npdp2o15.com, www.npdp20p15.com, www.npdp2p15.com, www.npdp20815.com, www.npdp2815.com, www.npdp20i15.com, www.npdp2i15.com, www.npdp20o15.com, www.npdp2o15.com, www.npdp205.com, www.npdp201l5.com, www.npdp20l5.com, www.npdp20105.com, www.npdp2005.com, www.npdp20195.com, www.npdp2095.com, www.npdp201.com, www.npdp2015e.com, www.npdp201e.com, www.npdp2015r.com, www.npdp201r.com, www.npdp20152.com, www.npdp2012.com, www.npdp2015t.com, www.npdp201t.com, www.npdp20153.com, www.npdp2013.com,

Other websites we recently analyzed

  1. flying-toasters.com - Diese Website steht zum Verkauf! - Informationen zum Thema flying-toasters.
    Diese
    Cambridge (United States) - 72.52.4.90
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 3
    Number of meta tags: 5
  2. Home - Precious Paws and Claws
    Precious Paws and Claws is a small family pet crematory secializing in private pet cremation.
    Wayne (United States) - 74.208.253.220
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  3. Lodge Justitia No.82
    India - 103.14.121.95
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 1
    Number of meta tags: 1
  4. readmansions.co.uk
    Gloucester (United Kingdom) - 88.208.252.9
    Server software: Microsoft-IIS/7.0
    Technology: Html
    Number of meta tags: 2
  5. Reload.LK - Reload/Recharge Prepaid Mobiles Online
    Kiel (Germany) - 83.125.22.184
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery, Php, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 1
  6. insurancecomments.com
    Houston (United States) - 192.185.29.249
    Server software: nginx/1.10.0
    Technology: Html
    Number of meta tags: 2
  7. hg57777.com
    hg57777.com
    Las Vegas (United States) - 70.39.84.241
    Server software:
    Technology: CSS, jQuery
    Number of Javascript: 1
    Number of meta tags: 4
  8. William & Brandi sittin' in a tree..
    William & Brandi's Wedding - August 21st Gale Woods Farm
    Culver City (United States) - 205.186.183.161
    Server software: Apache/2.2.22
    Technology: CSS, Google Font API, Html, Iframe, Javascript, Google Analytics, Wordpress
    Number of Javascript: 4
    Number of meta tags: 4
  9. Portail SCPI OPCI : Conseils d’experts pour investir
    Primaliance, le 1er portail dédié aux SCPI de rendement, SCPI fiscales et aux OPCI : toute l’information, les offres et les conseils pour bien investir.
    France - 46.105.42.212
    Server software: Apache/2.2.16 (Debian)
    Technology: DoubleClick.Net, CSS, Fancybox, Font Awesome, Google Font API, Html, Javascript, jQuery Cookie, jQuery Cycle, jQuery Fancybox, Google Analytics, Google AdWords Conversion Tracking, Google Remarketing, Facebook Box, Google +1 Button
    Number of Javascript: 19
    Number of meta tags: 6
  10. familievakantiekleinwalsertal.nl - Home
    Appartement in het Kleinwalsertal. Leuk appartement te huur in het Aparthotel in Kleinwalsertal. Beleef een heerlijke vakantie met het hele gezin. Winter of zomer, er is altijd wat te doen.
    Netherlands - 93.94.226.163
    Server software: Apache
    Technology: CSS, Html, Php
    Number of meta tags: 4

Check Other Websites